PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.162660.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 332aa    MW: 36768.9 Da    PI: 5.9686
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.162660.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.16.2e-082683012154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  Cucsa.162660.5 268 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 301
                     469*****************************87 PP

2ELK29.31.9e-10222243122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  Cucsa.162660.5 222 ELKHELKNGYKEKIVDIREEIL 243
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-185599IPR005540KNOX1
PfamPF037908.2E-175797IPR005540KNOX1
SMARTSM012566.5E-25110166IPR005541KNOX2
PfamPF037912.8E-18117165IPR005541KNOX2
PfamPF037891.7E-6222243IPR005539ELK domain
PROSITE profilePS512139.69222242IPR005539ELK domain
SMARTSM011887.4E-4222243IPR005539ELK domain
PROSITE profilePS5007111.677242305IPR001356Homeobox domain
SuperFamilySSF466895.56E-16244308IPR009057Homeodomain-like
SMARTSM003895.9E-11244309IPR001356Homeobox domain
CDDcd000868.49E-12245306No hitNo description
Gene3DG3DSA:1.10.10.602.7E-25249306IPR009057Homeodomain-like
PfamPF059207.0E-18262301IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MIGATATLSR ESDDLKNNSS GGGGDGVNNS DDVAVESDCN EGARGGEAAM NWQNAQFKAE  60
ILAHPLYEQL LSAHVACLRI ATPVDQLPRI DSQLSRSQNV AAKYSSLGNG SQSIVSNGKE  120
LDQFMTHYVF LLCSFKEQLQ QHVRVHAMEA VYACWEIEQS LQSLTGVSPG VGTGATMSDD  180
DEDQIDSDAM FDGSLEGHDT MGFGPLIPTE SERSLMERVR HELKHELKNG YKEKIVDIRE  240
EILRKRRAGK LPGDTTSVLK AWWQSHSKWP YPTEEDKAKL VQETGLQLKQ INNWFINQRK  300
RNWHTNPSTS TTLKTKRKRS NAGEATGNDH P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1298318RKRNWHTNPSTSTTLKTKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138713.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotP480001e-175KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0F6V0900.0A0A0F6V090_POPTO; TALE transcription factor
STRINGVIT_04s0008g06130.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-160KNOTTED1-like homeobox gene 3